PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010939032.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 364aa    MW: 40505.3 Da    PI: 4.7391
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010939032.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM453.3e-1427058128
             NAM  58 wyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     wy + + d ++ +g+ + ++t++gyWk  g  +  +s  + +vg k+t  fy g+ap+g kt W+mhey+ 
  XP_010939032.1   2 WYLYNPDDPQSLNGECEIKVTRTGYWKPMGGLRIFTS--TPTVGRKTTREFYIGKAPNGDKTGWTMHEYQT 70 
                     9*****************************9776665..889***************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100523.215193IPR003441NAC domain
SuperFamilySSF1019419.94E-19293IPR003441NAC domain
PfamPF023653.0E-6269IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MWYLYNPDDP QSLNGECEIK VTRTGYWKPM GGLRIFTSTP TVGRKTTREF YIGKAPNGDK  60
TGWTMHEYQT EQKTHQGINK EQDHCSLYRV FFQINERPNH EEQHNSMIAD AADGDYLEHV  120
LLNLLEQENN SSSSGAGNRS QMVGRDQQGQ SVLSGTSVTG PETDSSAEDV YATCDFSKGD  180
YLELNDLYSP GTSSSSSDNS SLMSVNSDEY FDADALLRDL ENEHNPRVEE EHADCRYSVS  240
ASVKSNQVVI RPPPSDAYVA QPFELPNILG LVIQQILFFE LKTCHSLIAL NAQFAVTVAV  300
IWWQKGAHLP IQCLKGHGLP ALPLLLMSYL ITGRLLVQAN LQVVIQTNLL PVVHVAAGLP  360
EVRD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-1229173163NO APICAL MERISTEM PROTEIN
1ut4_B3e-1229173163NO APICAL MERISTEM PROTEIN
1ut7_A3e-1229173163NO APICAL MERISTEM PROTEIN
1ut7_B3e-1229173163NO APICAL MERISTEM PROTEIN
3swm_A4e-1229176166NAC domain-containing protein 19
3swm_B4e-1229176166NAC domain-containing protein 19
3swm_C4e-1229176166NAC domain-containing protein 19
3swm_D4e-1229176166NAC domain-containing protein 19
3swp_A4e-1229176166NAC domain-containing protein 19
3swp_B4e-1229176166NAC domain-containing protein 19
3swp_C4e-1229176166NAC domain-containing protein 19
3swp_D4e-1229176166NAC domain-containing protein 19
4dul_A3e-1229173163NAC domain-containing protein 19
4dul_B3e-1229173163NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010939032.10.0PREDICTED: uncharacterized protein LOC105057977 isoform X4
RefseqXP_010939033.10.0PREDICTED: uncharacterized protein LOC105057977 isoform X4
TrEMBLM0TKU12e-82M0TKU1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P26050_0016e-82(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.12e-15NAC domain containing protein 28